PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G123400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 689aa    MW: 77365.2 Da    PI: 7.8082
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G123400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.2e-13115156345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           rW+ eE e l + v+++G+++W tIa  ++ gR + +c srw 
  Sobic.004G123400.1.p 115 RWSSEENEALTQMVNKHGTKDWQTIACAIP-GRNAHSCFSRWK 156
                           9*****************************.***********7 PP

2Myb_DNA-binding34.45.1e-11165207145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           + +W+++E+++l++a + +G++ W +  ++++ gRt   +k++w+
  Sobic.004G123400.1.p 165 KEPWSQQEELRLIRAQQVYGNK-WCKMVKHFP-GRTNGALKEHWR 207
                           679*******************.*********.***********7 PP

3Myb_DNA-binding42.61.4e-13372414145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           +g+W +eE e+l + v+++G++ W t+a+ ++ gR +kqc+ rw 
  Sobic.004G123400.1.p 372 KGKWLAEENEILTKMVAKHGKN-WQTVASAIP-GREAKQCRIRWT 414
                           79******************99.*********.***********5 PP

4Myb_DNA-binding33.41e-10425465345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            W+++E+++l++a++ +G+  W +  ++++ gRt   +k++w+
  Sobic.004G123400.1.p 425 GWSEQEELKLIRAHQIYGSQ-WLKMVKHFP-GRTNHALKEHWR 465
                           6*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.821108157IPR017930Myb domain
SMARTSM007174.9E-10112161IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-24114206IPR009057Homeodomain-like
CDDcd001671.46E-9115159No hitNo description
Gene3DG3DSA:1.10.10.602.4E-18115168IPR009057Homeodomain-like
PfamPF139214.6E-14116176No hitNo description
PROSITE profilePS5129419.174160214IPR017930Myb domain
SMARTSM007171.2E-11164212IPR001005SANT/Myb domain
CDDcd001672.98E-8167207No hitNo description
Gene3DG3DSA:1.10.10.604.1E-16169214IPR009057Homeodomain-like
PROSITE profilePS5129419.781367421IPR017930Myb domain
SuperFamilySSF466899.17E-22369464IPR009057Homeodomain-like
SMARTSM007178.7E-13371419IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-20373424IPR009057Homeodomain-like
CDDcd001672.65E-8374417No hitNo description
PfamPF139213.7E-15375434No hitNo description
PROSITE profilePS5129412.862422472IPR017930Myb domain
SMARTSM007177.9E-10422470IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-15425472IPR009057Homeodomain-like
CDDcd001674.71E-8426465No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MEQSSDGVPI NQRRANSPTE HPSKSDEVAQ DMLQSDIPHE TVRHCQNAES EETGSWLLAL  60
QAHLKKGSQQ DMSDIPHEPV RHCQDTESEG IEGPPRKKIV HSFKESSSSK SQIRRWSSEE  120
NEALTQMVNK HGTKDWQTIA CAIPGRNAHS CFSRWKYILD PAINKEPWSQ QEELRLIRAQ  180
QVYGNKWCKM VKHFPGRTNG ALKEHWRGSM KRKLDSYLAS GLLEHIPDLQ DDVSFPQSNQ  240
SDIPKDCKAA SDRNRFSSRL STNPKLKQEL TELVENANTS ARKSSDLFYA KAPDTHSAKI  300
SEMTMAKSQQ CAGTRKKLAF LSTPVELKNV VPHETTKHCH DMESEKTEVP LCKKNAHCIK  360
DGSSLKIPER AKGKWLAEEN EILTKMVAKH GKNWQTVASA IPGREAKQCR IRWTRSLDPA  420
INKEGWSEQE ELKLIRAHQI YGSQWLKMVK HFPGRTNHAL KEHWRGRMKG KLNFYLASGL  480
LEQVPDLEED ISVPESSQSD ILKDSQGSSD RSRPPSVLRT RPKSKQELPE LDENAGTSEE  540
ETSACICPKG PNAHSAKVSE KVLAKSKQRA RARRKLDFLS TPVELKVCTA AASCARPPLK  600
MDQMSPAADN ISASDVCQDI SQNVPSERVD AIIPPAANNH RNDLHSPATL DPFFLEMHEV  660
NASDLLDMSY CDDLIIDSPC YPHDGSFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-221164732110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008645507.10.0PREDICTED: uncharacterized protein LOC103626929 isoform X2
TrEMBLA0A0A9FY270.0A0A0A9FY27_ARUDO; Uncharacterized protein
TrEMBLC5Y0010.0C5Y001_SORBI; Putative uncharacterized protein Sb04g010300
STRINGSb04g010300.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.17e-37myb domain protein 3r-4